PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589175.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 835aa    MW: 94513.8 Da    PI: 5.5678
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589175.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK506e-16646690448
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                      is ++l+++F +++ dAAk+Lgv  ++LKr CR y I RWP+ k
  XP_009589175.1 646 GISRSVLEEQFGKKLSDAAKSLGVARSTLKRMCRDYDIYRWPRSK 690
                     6999**************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.843631716IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.602.7E-4632682IPR009057Homeodomain-like
PfamPF020424.2E-13647690IPR003035RWP-RK domain
SuperFamilySSF542777.2E-17748833No hitNo description
SMARTSM006662.4E-15751834IPR000270PB1 domain
PROSITE profilePS5174518.234751835IPR000270PB1 domain
PfamPF005647.7E-15752833IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.8E-15753832No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MRERKRGDGI NRWVFWTQHN GDELNQVKSL FPVLRGYEFE PWKQPPVEMQ GDSTQPDTNG  60
DSQLNRLTIK NLVELLDVQG TCLIQFWAPI RINSGKTFLT TADQPFAFNG KIHEGLWAYR  120
RVSLLTIASV DSTEIDETKR VHVHGRPARV FRSGMPEFSP HVRYYYMDEY PLRNFAMCLG  180
VGSYWTLPVF ESSGDRCIGV LEYAFEANVG LDLYSTLDCL INNHRILKTM GLALIPSWLA  240
CSQEIQEVWE QELAKVKEAL EVTCKTHRLL FAQTWISVLD SSRTQMLITS PPTKYWSEEI  300
TSLEFLAVSD LHHVRIGQGL VGKVLSSKGS CFCRDITQLS IDFYPFVPIA RCAGFTACFA  360
IFVRLNSACH MVLEFFLPND ETLDRNPQSF LSKLLATIRE QLPSFFLDSG PSLFVEVIRT  420
APVDELDSFE ISQLQQGVRS KGNEKMVLFD SLNQDSADLG PSSSTDIGAH HMEIAKDTPD  480
NGEETVLPDS AHKQGVEEAD AMDKEKSSVD FILATSFAVS EKKLQQNLST DKASLDEKLD  540
SFEIGHRQLP SMVQYDTINQ IFGFDPSSSS DLEEIITADY GRDTQLNLQS KKRGESTQPD  600
LAHQQRVEEA DVGDKRRHSV HVEENANSHN CPEKHKRIKR IEKEYGISRS VLEEQFGKKL  660
SDAAKSLGVA RSTLKRMCRD YDIYRWPRSK SANDVCSLSE NKPVKRVENQ TGNSSREDLQ  720
LPHAGLSNGM DTTTTLTQRK KPTATFQSDN AMSVKVTYKD VTIRFPFSLS SGKIDLETEV  780
EKRLKLVLIG SYSIKYEDED NDWIAITCDS DLEYGMHTLR SLGRTTMKML VEPLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589175.10.0PREDICTED: protein NLP7-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.13e-41NIN like protein 7